Loading...
Statistics
Advertisement

Huard et compagnie
www.huardetcompagnie.com/
Établir un excellent service à notre clientèle, et ce, avant et après vente afin de développer une relation durable avec les clients, basée ...

Huardetcompagnie.com

Advertisement
Huardetcompagnie.com is hosted in United States / Newark . Huardetcompagnie.com uses HTTPS protocol. Number of used technologies: 6. First technologies: CSS, Flexslider, Html, Number of used javascripts: 10. First javascripts: Jquery.min.js, Jquery-noconflict.js, Jquery-migrate.min.js, Number of used analytics tools: 1. First analytics tools: Google Analytics, Number of used plugins, modules: 1. Its server type is: Apache.

Technologies in use by Huardetcompagnie.com

Technology

Number of occurences: 6
  • CSS
  • Flexslider
  • Html
  • Html5
  • Javascript
  • Schema.org

Advertisement

Javascripts

Number of occurences: 10
  • jquery.min.js
  • jquery-noconflict.js
  • jquery-migrate.min.js
  • caption.js
  • jcemediabox.js
  • bootstrap.min.js
  • template.js
  • jquery.flexslider.js
  • jquery.mousewheel.js
  • pinit.js

Analytics

Number of occurences: 1
  • Google Analytics

Server Type

  • Apache

Powered by

  • PHP/5.5.29

Social

Number of occurences: 1
  • Facebook Box

Used plugins, modules

Number of plugins and modules: 1
  • mod favslider

Google Analytics ID

  • UA-440827-45

Conversion rate optimization

visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Not founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Founded!
visitors List Founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Huardetcompagnie.com

SSL certificate

    • name: /OU=Domain Control Validated/OU=PositiveSSL/CN=chiboum.gnitic.com
    • subject:
      • OU:
        • 0: Domain Control Validated
        • 1: PositiveSSL
      • CN: chiboum.gnitic.com
    • hash: 102ac8ee
    • issuer:
      • C: US
      • ST: TX
      • L: Houston
      • O: cPanel, Inc.
      • CN: cPanel, Inc. Certification Authority
    • version: 2
    • serialNumber: 318914785870822628598156884947281110448
    • validFrom: 160429000000Z
    • validTo: 170429235959Z
    • validFrom_time_t: 1461888000
    • validTo_time_t: 1493510399
    • extensions:
      • authorityKeyIdentifier: keyid:7E:03:5A:65:41:6B:A7:7E:0A:E1:B8:9D:08:EA:1D:8E:1D:6A:C7:65
      • subjectKeyIdentifier: B2:D1:76:54:59:44:0E:E7:65:FD:D7:20:1F:FF:84:E7:28:07:59:82
      • keyUsage: Digital Signature, Key Encipherment
      • basicConstraints: CA:FALSE
      • extendedKeyUsage: TLS Web Server Authentication, TLS Web Client Authentication
      • certificatePolicies: Policy: 1.3.6.1.4.1.6449.1.2.2.52 CPS: https://secure.comodo.com/CPS Policy: 2.23.140.1.2.1
      • crlDistributionPoints: Full Name: URI:http://crl.comodoca.com/cPanelIncCertificationAuthority.crl
      • authorityInfoAccess: CA Issuers - URI:http://crt.comodoca.com/cPanelIncCertificationAuthority.crt OCSP - URI:http://ocsp.comodoca.com
      • subjectAltName: DNS:chiboum.gnitic.com, DNS:www.chiboum.gnitic.com

Meta - Huardetcompagnie.com

Number of occurences: 8
  • Name: viewport
    Content: width=device-width, initial-scale=1.0
  • Name:
    Content: text/html; charset=utf-8
  • Name: keywords
    Content: Mode, Déco, décoration, cuisine, magasin, commerce, jouet
  • Name: description
    Content: Établir un excellent service à notre clientèle, et ce, avant et après vente afin de développer une relation durable avec les clients, basée principalement sur la confiance.
  • Name: generator
    Content: Joomla! - Open Source Content Management
  • Name: msapplication-TileColor
    Content: #ffffff
  • Name: msapplication-TileImage
    Content: /ms-icon-144x144.png
  • Name: theme-color
    Content: #ffffff

Server / Hosting

  • IP: 97.107.130.147
  • Latitude: 40.74
  • Longitude: -74.17
  • Country: United States
  • City: Newark

Rname

  • pdns04.domaincontrol.com
  • pdns03.domaincontrol.com
  • mailstore1.secureserver.net
  • smtp.secureserver.net

Target

  • dns.jomax.net

HTTP Header Response

HTTP/1.1 200 OK Date: Tue, 02 Aug 2016 15:30:33 GMT Server: Apache X-Powered-By: PHP/5.5.29 P3P: CP="NOI ADM DEV PSAi COM NAV OUR OTRo STP IND DEM" Expires: Wed, 17 Aug 2005 00:00:00 GMT Cache-Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0 Pragma: no-cache Set-Cookie: 6177abcfb871434613bfb32b947ba4ec=5f5a800ef2c0546afc453ae1d714ea3e; path=/; HttpOnly Last-Modified: Tue, 02 Aug 2016 15:30:33 GMT Content-Type: text/html; charset=utf-8 X-Cache: MISS from s_sr109 X-Cache-Lookup: MISS from s_sr109:80 Transfer-Encoding: chunked Via: 1.1 s_sr109 (squid/3.5.14) Connection: keep-alive

DNS

host: huardetcompagnie.com
  1. class: IN
  2. ttl: 3600
  3. type: A
  4. ip: 97.107.130.147
host: huardetcompagnie.com
  1. class: IN
  2. ttl: 3600
  3. type: NS
  4. target: pdns04.domaincontrol.com
host: huardetcompagnie.com
  1. class: IN
  2. ttl: 3600
  3. type: NS
  4. target: pdns03.domaincontrol.com
host: huardetcompagnie.com
  1. class: IN
  2. ttl: 3600
  3. type: SOA
  4. mname: pdns03.domaincontrol.com
  5. rname: dns.jomax.net
  6. serial: 2016050200
  7. refresh: 28800
  8. retry: 7200
  9. expire: 604800
  10. minimum-ttl: 600
host: huardetcompagnie.com
  1. class: IN
  2. ttl: 3600
  3. type: MX
  4. pri: 10
  5. target: mailstore1.secureserver.net
host: huardetcompagnie.com
  1. class: IN
  2. ttl: 3600
  3. type: MX
  4. pri: 0
  5. target: smtp.secureserver.net

Common Typos/Mistakes

This list shows You some spelling mistakes at internet search for this domain.

www.uardetcompagnie.com, www.heuardetcompagnie.com, www.euardetcompagnie.com, www.hduardetcompagnie.com, www.duardetcompagnie.com, www.hcuardetcompagnie.com, www.cuardetcompagnie.com, www.huuardetcompagnie.com, www.uuardetcompagnie.com, www.hjuardetcompagnie.com, www.juardetcompagnie.com, www.huardetcompagnie.com, www.uardetcompagnie.com, www.hbuardetcompagnie.com, www.buardetcompagnie.com, www.hguardetcompagnie.com, www.guardetcompagnie.com, www.hardetcompagnie.com, www.huwardetcompagnie.com, www.hwardetcompagnie.com, www.hueardetcompagnie.com, www.heardetcompagnie.com, www.husardetcompagnie.com, www.hsardetcompagnie.com, www.huaardetcompagnie.com, www.haardetcompagnie.com, www.hurdetcompagnie.com, www.huaordetcompagnie.com, www.huordetcompagnie.com, www.huaprdetcompagnie.com, www.huprdetcompagnie.com, www.hua9rdetcompagnie.com, www.hu9rdetcompagnie.com, www.huardetcompagnie.com, www.hurdetcompagnie.com, www.huairdetcompagnie.com, www.huirdetcompagnie.com, www.huaurdetcompagnie.com, www.huurdetcompagnie.com, www.huadetcompagnie.com, www.huaridetcompagnie.com, www.huaidetcompagnie.com, www.huarodetcompagnie.com, www.huaodetcompagnie.com, www.huarldetcompagnie.com, www.hualdetcompagnie.com, www.huarldetcompagnie.com, www.hualdetcompagnie.com, www.huar.detcompagnie.com, www.hua.detcompagnie.com, www.huaretcompagnie.com, www.huardtetcompagnie.com, www.huartetcompagnie.com, www.huardgetcompagnie.com, www.huargetcompagnie.com, www.huardbetcompagnie.com, www.huarbetcompagnie.com, www.huardxetcompagnie.com, www.huarxetcompagnie.com, www.huardsetcompagnie.com, www.huarsetcompagnie.com, www.huardfetcompagnie.com, www.huarfetcompagnie.com, www.huardvetcompagnie.com, www.huarvetcompagnie.com, www.huardyetcompagnie.com, www.huaryetcompagnie.com, www.huardzetcompagnie.com, www.huarzetcompagnie.com, www.huardaetcompagnie.com, www.huaraetcompagnie.com, www.huardeetcompagnie.com, www.huareetcompagnie.com, www.huardretcompagnie.com, www.huarretcompagnie.com, www.huardtcompagnie.com, www.huardextcompagnie.com, www.huardxtcompagnie.com, www.huardestcompagnie.com, www.huardstcompagnie.com, www.huardewtcompagnie.com, www.huardwtcompagnie.com, www.huardertcompagnie.com, www.huardrtcompagnie.com, www.huardeftcompagnie.com, www.huardftcompagnie.com, www.huardevtcompagnie.com, www.huardvtcompagnie.com, www.huardectcompagnie.com, www.huardctcompagnie.com, www.huardeqtcompagnie.com, www.huardqtcompagnie.com, www.huardeatcompagnie.com, www.huardatcompagnie.com, www.huardeytcompagnie.com, www.huardytcompagnie.com, www.huardecompagnie.com, www.huardetqcompagnie.com, www.huardeqcompagnie.com, www.huardetacompagnie.com, www.huardeacompagnie.com, www.huardet compagnie.com, www.huarde compagnie.com, www.huardetwcompagnie.com, www.huardewcompagnie.com, www.huardetecompagnie.com, www.huardeecompagnie.com, www.huardetzcompagnie.com, www.huardezcompagnie.com, www.huardetxcompagnie.com, www.huardexcompagnie.com, www.huardetccompagnie.com, www.huardeccompagnie.com, www.huardetompagnie.com, www.huardetcdompagnie.com, www.huardetdompagnie.com, www.huardetcrompagnie.com, www.huardetrompagnie.com, www.huardetctompagnie.com, www.huardettompagnie.com, www.huardetcvompagnie.com, www.huardetvompagnie.com, www.huardetcfompagnie.com, www.huardetfompagnie.com, www.huardetcgompagnie.com, www.huardetgompagnie.com, www.huardetchompagnie.com, www.huardethompagnie.com, www.huardetcnompagnie.com, www.huardetnompagnie.com, www.huardetcmompagnie.com, www.huardetmompagnie.com, www.huardetcjompagnie.com, www.huardetjompagnie.com, www.huardetcmpagnie.com, www.huardetcobmpagnie.com, www.huardetcbmpagnie.com, www.huardetcohmpagnie.com, www.huardetchmpagnie.com, www.huardetcogmpagnie.com, www.huardetcgmpagnie.com, www.huardetcojmpagnie.com, www.huardetcjmpagnie.com, www.huardetcommpagnie.com, www.huardetcmmpagnie.com, www.huardetco mpagnie.com, www.huardetc mpagnie.com, www.huardetcovmpagnie.com, www.huardetcvmpagnie.com, www.huardetcopagnie.com, www.huardetcomppagnie.com, www.huardetcoppagnie.com, www.huardetcomopagnie.com, www.huardetcoopagnie.com, www.huardetcomipagnie.com, www.huardetcoipagnie.com, www.huardetcomkpagnie.com, www.huardetcokpagnie.com, www.huardetcom.pagnie.com, www.huardetco.pagnie.com, www.huardetcomupagnie.com, www.huardetcoupagnie.com, www.huardetcomjpagnie.com, www.huardetcojpagnie.com, www.huardetcomnpagnie.com, www.huardetconpagnie.com, www.huardetcom-pagnie.com, www.huardetco-pagnie.com,

Other websites we recently analyzed

  1. moneylink24.org
    United States - 208.91.197.27
    Server software: Apache
    Technology: Html
    Number of meta tags: 2
  2. westvirginiacarwrecklawyer.info
    Scottsdale (United States) - 184.168.221.52
    Server software: Microsoft-IIS/7.5
    Technology: Html, Html5, Iframe
  3. Мужская, женская обувь оптом, сумки оптом, тапочки оптом
    Поставляем обувь оптом, женские сумки оптом, тапочки оптом, женская обувь оптом, мужская обувь оптом, домашняя обувь оптом, резиновая обувь оптом, Обувь Инблу ( INBLU ), NOKIAN финская обувь.
    Russian Federation - 195.144.251.230
    Server software: nginx/1.2.4
    Technology: AJAX Libraries API, CSS, Google Font API, Html, Html5, Javascript, jQuery, jQuery UI, Php, Yandex.Metrika
    Number of Javascript: 10
    Number of meta tags: 7
  4. Sekai Ichi Indonesia MLM | Sekaichi Indonesia
    MLM Sekai Ichi Indonesia, Peluang Bisnis Sekaichi Indonesia, Dicari Leader di Seluruh Indonesia!
    Houston (United States) - 192.185.225.29
    Server software: nginx/1.8.1
    Technology: CSS, Html, Html5, Javascript, Php, Pingback, Wordpress
    Number of Javascript: 1
    Number of meta tags: 5
  5. Equus Foods - Cinque Olive Oil
    Established in 2007, Equus Foods is a family-owned and operated importer and distributor of artisan produced organic and gourmet foods. We pride ourselves in supplier our clients with only the finest natural and organic gourmet products available from around the world.
    Sunnyvale (United States) - 67.195.61.46
    Server software: ATS/5.3.0
    Technology: CSS, Html, Javascript, Php, Lexity
    Number of Javascript: 1
    Number of meta tags: 5
  6. Superpole Exhausts | Superkwaliteit van fabrikant naar klant
    Superpole produceert schitterende dempers voor de echte motorliefhebber. Daarnaast kun je er terecht voor; motor accessoires, onderhoud service, circuit service en bandenservice.
    Netherlands - 5.157.84.25
    Server software: Apache
    Technology: CSS, Html, Html5, Iframe, jQuery Colorbox, jQuery Cycle, Php, Google Analytics, Drupal, Facebook Like box
    Number of Javascript: 7
    Number of meta tags: 6
  7. Õîñòèíã Îáûêíîâåííûé, áåñïëàòíî: Ñòðàíèöà íå íàéäåíà
    Íåäîðîãîé èëè áåñïëàòíûé õîñòèíã: 1 Ãá, Perl, PHP, MySQL, SSI, Python. Íåäîðîãîé vps.
    Ukraine - 91.228.146.12
    Server software: Apache/2.4.23 (FreeBSD)
    Technology: Google Adsense, CSS, Javascript, Php, Rambler
    Number of Javascript: 1
    Number of meta tags: 2
  8. cadbrothers.com
    Road Town (Virgin Islands, British) - 208.91.197.44
    Server software: Apache
    Technology: Html
    Number of meta tags: 2
  9. Kein Inhalt
    Germany - 144.76.213.4
    Server software: Apache/2.2.22 (Debian)
    Technology: CSS, Google Font API, Html, Html5
    Number of Javascript: 5
    Number of meta tags: 4
  10. Home
    San Francisco (United States) - 74.122.232.20
    Server software: Apache
    Technology: CSS, Google Font API, Html, Html5, Javascript, Php
    Number of Javascript: 4
    Number of meta tags: 4

Check Other Websites